ExMulAlign-Answers

From teachingmaterials

Jump to: navigation, search

Contents

Svar til Multiple Alignment øvelsen

Af: Rasmus Wernersson

Spørgsmål 1

Fasta fil:

>pigeon_alpha-globin-D
ATGCTGACCGACTCTGACAAGAAGCTGGTCCTGCAGGTGTGGGAGAAGGTGATCCGCCACCCAGACTGTG
GAGCCGAGGCCCTGGAGAGGCTGTTCACCACCTACCCCCAGACCAAGACCTACTTCCCCCACTTCGACTT
GCACCATGGCTCCGACCAGGTCCGCAACCACGGCAAGAAGGTGTTGGCCGCCTTGGGCAACGCTGTCAAG
AGCCTGGGCAACCTCAGCCAAGCCCTGTCTGACCTCAGCGACCTGCATGCCTACAACCTGCGTGTCGACC
CTGTCAACTTCAAGCTGCTGGCGCAGTGCTTCCACGTGGTGCTGGCCACACACCTGGGCAACGACTACAC
CCCGGAGGCACATGCTGCCTTCGACAAGTTCCTGTCGGCTGTGTGCACCGTGCTGGCCGAGAAGTACAGA
TAA
>pigeon_alpha-globin-A
ATGGTGCTGTCTGCCAACGACAAGAGCAACGTGAAGGCCGTCTTCGGCAAAATCGGCGGCCAGGCCGGTG
ACTTGGGTGGTGAAGCCCTGGAGAGGTTGTTCATCACCTACCCCCAGACCAAGACCTACTTCCCCCACTT
CGACCTGTCACATGGCTCCGCTCAGATCAAGGGGCACGGCAAGAAGGTGGCGGAGGCACTGGTTGAGGCT
GCCAACCACATCGATGACATCGCTGGTGCCCTCTCCAAGCTGAGCGACCTCCACGCCCAAAAGCTCCGTG
TGGACCCCGTCAACTTCAAACTGCTGGGTCACTGCTTCCTGGTGGTCGTGGCCGTCCACTTCCCCTCTCT
CCTGACCCCGGAGGTCCATGCTTCCCTGGACAAGTTCGTGTGTGCCGTGGGCACCGTCCTTACTGCCAAG
TACCGTTAA
>duck_alpha-globin-D
ATGCTGACCGCCGAGGACAAGAAGCTCATCGTGCAGGTGTGGGAGAAGGTGGCTGGCCACCAGGAGGAAT
TCGGAAGTGAAGCTCTGCAGAGGATGTTCCTCGCCTACCCCCAGACCAAGACCTACTTCCCCCACTTCGA
CCTGCATCCCGGCTCTGAACAGGTCCGTGGCCATGGCAAGAAAGTGGCGGCTGCCCTGGGCAATGCCGTG
AAGAGCCTGGACAACCTCAGCCAGGCCCTGTCTGAGCTCAGCAACCTGCATGCCTACAACCTGCGTGTTG
ACCCTGTCAACTTCAAGCTGCTGGCACAGTGCTTCCAGGTGGTGCTGGCCGCACACCTGGGCAAAGACTA
CAGCCCCGAGATGCATGCTGCCTTTGACAAGTTCTTGTCCGCCGTGGCTGCCGTGCTGGCTGAAAAGTAC
AGATGA
>duck_alpha-A-globin
ATGGTGCTGTCTGCGGCTGACAAGACCAACGTCAAGGGTGTCTTCTCCAAAATCGGTGGCCATGCTGAGG
AGTATGGCGCCGAGACCCTGGAGAGGATGTTCATCGCCTACCCCCAGACCAAGACCTACTTCCCCCACTT
TGACCTGCAGCACGGCTCTGCTCAGATCAAGGCCCATGGCAAGAAGGTGGCGGCTGCCCTAGTTGAAGCT
GTCAACCACATCGATGACATTGCGGGTGCTCTCTCCAAGCTCAGTGACCTCCACGCCCAAAAGCTCCGTG
TGGACCCTGTCAACTTCAAATTCCTGGGCCACTGCTTCCTGGTGGTGGTTGCCATCCACCACCCCGCTGC
CCTGACCCCAGAGGTCCACGCTTCCCTGGACAAGTTCATGTGCGCCGTGGGTGCTGTGCTGACTGCCAAG
TACCGTTAG
>Goat_alpha-i-globin
ATGGTGCTGTCTGCCGCCGACAAGTCCAATGTCAAGGCCGCCTGGGGCAAGGTTGGCGGCAACGCTGGAG
CTTATGGCGCAGAGGCTCTGGAGAGGATGTTCCTGAGCTTCCCCACCACCAAGACCTACTTCCCCCACTT
CGACCTGAGCCACGGCTCGGCCCAGGTCAAGGGCCACGGCGAGAAGGTGGCCGCCGCGCTGACCAAAGCG
GTGGGCCACCTGGACGACCTGCCCGGTACTCTGTCTGATCTGAGTGACCTGCACGCCCACAAGCTGCGTG
TGGACCCGGTCAACTTTAAGCTTCTGAGCCACTCCCTGCTGGTGACCCTGGCCTGCCACCTCCCCAATGA
TTTCACCCCCGCGGTCCACGCCTCCCTGGACAAGTTCTTGGCCAACGTGAGCACCGTGCTGACCTCCAAA
TACCGTTAA
>Goat_alpha-ii-globin
ATGGTGCTGTCTGCCGCCGACAAGTCCAATGTCAAGGCCGCCTGGGGCAAGGTTGGCAGCAACGCTGGAG
CTTATGGCGCAGAGGCTCTGGAGAGGATGTTCCTGAGCTTCCCCACCACCAAGACCTACTTCCCCCACTT
CGACCTGAGCCACGGCTCGGCCCAGGTCAAGGGCCACGGCGAGAAGGTGGCCGCCGCGCTGACCAAAGCG
GTGGGCCACCTGGACGACCTGCCCGGTACTCTGTCTGATCTGAGTGACCTGCACGCCCACAAGCTGCGTG
TGGACCCGGTCAACTTTAAGCTTCTGAGCCACTCCCTGCTGGTGACCCTGGCCTGCCACCACCCCAGTGA
TTTCACCCCCGCGGTCCACGCCTCCCTGGACAAGTTCTTGGCCAACGTGAGCACCGTGCTGACCTCCAAA
TACCGTTAA
>Horse_alpha-1_globin
ATGGTGCTGTCTGCCGCCGACAAGACCAACGTCAAGGCCGCCTGGAGTAAGGTTGGCGGCCACGCTGGCG
AGTTTGGCGCAGAGGCCCTAGAGAGGATGTTCCTGGGCTTCCCCACCACCAAGACCTACTTCCCCCACTT
CGATCTGAGCCACGGCTCCGCCCAGGTCAAGGCCCACGGCAAGAAGGTGGGCGACGCGCTGACTCTCGCC
GTGGGCCACCTGGACGACCTGCCTGGCGCCCTGTCGAATCTGAGCGACCTGCACGCACACAAGCTGCGCG
TGGACCCCGTCAACTTCAAGCTTCTGAGTCATTGCCTGCTGTCCACCTTGGCCGTCCACCTCCCCAACGA
TTTCACCCCTGCCGTCCACGCCTCCCTGGACAAGTTCTTGAGCAGTGTGAGCACCGTGCTGACCTCCAAA
TACCGTTAA
>Horse_alpha-2_globin
ATGGTGCTGTCTGCCGCCGACAAGACCAACGTCAAGGCCGCCTGGAGTAAGGTTGGCGGCCACGCTGGCG
AGTATGGCGCAGAGGCCCTAGAGAGGATGTTCCTGGGCTTCCCCACCACCAAGACCTACTTCCCCCACTT
CGATCTGAGCCACGGCTCCGCCCAGGTCAAGGCCCACGGCCAGAAGGTGGGCGACGCGCTGACTCTCGCC
GTGGGCCACCTGGACGACCTGCCTGGCGCCCTGTCGAATCTGAGCGACCTGCACGCACACAAGCTGCGCG
TGGACCCCGTCAACTTCAAGCTCCTGAGTCATTGCCTGCTGTCCACCTTGGCCGTCCACCTCCCCAACGA
TTTCACCCCTGCCGTCCACGCCTCCCTGGACAAGTTCTTGAGCAGTGTGAGCACCGTGCTGACCTCCAAA
TACCGTTAA
>Chicken_alpha-D
ATGCTGACTGCCGAGGACAAGAAGCTCATCCAGCAGGCCTGGGAGAGGGCCGCTTCCCACCAGGAGGAGT
TTGGAGCTGAGGCTCTGACTAGGATGTTCACCACCTATCCCCAGACCAAGACCTACTTCCCCCACTTCGA
CCTTTCGCCTGGCTCTGACCAGGTCCGTGGCCATGGCAAGAAGGTGTTGGGTGCCCTGGGCAACGCCGTG
AAGAACGTGGACAACCTCAGCCAGGCCATGGCTGAGCTGAGCAACCTGCATGCCTACAACCTGCGTGTTG
ACCCCGTCAATTTCAAGCTGTTGTCGCAGTGCATCCAGGTGGTGCTGGCTGTACACATGGGCAAAGACTA
CACCCCTGAAGTGCATGCTGCCTTCGACAAGTTCCTGTCTGCCGTGTCTGCTGTGCTGGCTGAGAAGTAC
AGATAA
>Chicken_alpha-A
ATGGTGCTGTCCGCTGCTGACAAGAACAACGTCAAGGGCATCTTCACCAAAATCGCCGGCCATGCTGAGG
AGTATGGCGCCGAGACCCTGGAAAGGATGTTCACCACCTACCCCCCAACCAAGACCTACTTCCCCCACTT
CGATCTGTCACACGGCTCCGCTCAGATCAAGGGGCACGGCAAGAAGGTAGTGGCTGCCTTGATCGAGGCT
GCCAACCACATTGATGACATCGCCGGCACCCTCTCCAAGCTCAGCGACCTCCATGCCCACAAGCTCCGCG
TGGACCCTGTCAACTTCAAACTCCTGGGCCAATGCTTCCTGGTGGTGGTGGCCATCCACCACCCTGCTGC
CCTGACCCCGGAGGTCCATGCTTCCCTGGACAAGTTCTTGTGCGCCGTGGGCACTGTGCTGACCGCCAAG
TACCGTTAA

BEMÆRK:

  • Det er vigtigt at bruge KORTE, beskrivende navne. I alignmentet i Clustal format vises kun de første 15 tegn i navnene, så hvis man har meget lange navne kan outputtet blive svært at læse (SE OGSÅ FASTA HANDOUTET FRA LEKTION 2). Bemærk at Jalview fejler på en meget uigennemskuelig måde hvis navnene ikke er unikke inden for de første 15 tegn — den lægger simpelthen sekvenser i forlængelse af hinanden, hvis den "synes" de hedder det samme!
  • Mellemrum er ikke en del af navnet i en FASTA-fil. Hvis der er mellemrum, er det kun første ord efter ">", der er navnet, de efterfølgende ord er kommentarer. Hvis jeg havde brugt mellemrum i stedet for underscore ("_") i filen ovenfor, havde navnene ikke været unikke (der havde været to, der hed "duck" osv.).
  • Vær opmærksom på at i GenBank entries der indeholder flere gener (SE GENBANK HANDOUT'ET FRA LEKTION 2) findes navnet på det enkelte gen (CDS) nede i selve feature-tabellen. Når i klikker på et CDS der har "/gene_name=XYZ" eller lignende. er det derfor XYZ I skal bruge som navn i jeres FASTA fil og ikke den samlede titel for HELE GenBank entry'en (fx. "Alpha-A and Alpha-D genes ..." eller "Yeast Chromosome 2"). Se også det screenshot/handout der hører til øvelsen.
  • Det sidste GenBank entry ("AF098919" - kylling) indeholder tre gener: "embryonic alpha-type globin pi", "adult alpha D globin" og "adult alpha A globin". Jeg har her valgt kun at tage de to sidste med, da den første kun står beskrevet som "alpha-type". Man kan godt tage "embryonic alpha-type globin pi" med, for at være påpasselig med at ikke smide for meget væk - man vil så se, at den lægger sig for sig selv i det afstands-træ MAFFT producerer. Dette er en god indikator på at den er noget anderledes. Man kan så evt. gå tilbage og fjerne den, eller skrive en bemærkning om at den ligger for sig selv.

Når man bygger er "rigtigt" datasæt til et forskningsprojekt, er dette ofte en iterativ proces, hvor man 1) samler sine sekvenser, 2) luger ud i dem, 3) kører en analyse og gentager 2) og 3) indtil man er tilfreds med resultatet.

Spørgsmål 2

  • "*" betyder at baserne er helt ens i en given position (perfekt konserveret).
  • Hvis man ikke har "alpha-type" sekvensen med er der et enkelt område på mere end 12 baser, der er perfekt konserveret. Hvis man har tager "alpha-type" sekvensen med, er det kun 11 baser i dette område, der er perfekt konserveret.
  • Ang. "guide tree"
    • 3 clusters (+ en "løs" gruppe, hvis man har "alpha-type" sekvensen med): En Alpha-A (kun fugle), en Alpha-D (kun fugle) og en Alpha 1 + Alpha 2 cluster (pattedyr).
    • Ideen er her at fugle og pattedyr ikke blandes - så de ligger naturligt taxonomisk set.
    • Alpha-A og Alpha-D ligger tydeligvis i hver sin cluster - det må nødvendigvis betyde at splittet mellem dem er gammelt. Da både alpha-a og alpha-d findes hos de tre fugle vi har med, må splittet mellem dem være ældre end den sidste fælles forfader til fuglene.
    • Alpha-1 og Alpha-2 ser ud til at være væsentligt tættere beslægtede - husk at et guide-tree kun er et rimeligt råt estimat på slægtskabet, så hvis vi skal grave dybere i hvornår alpha-1 og alpha-2 er splittet ud, skal vi have gang i en egentlig fylogenetisk analyse.

Spørgsmål 3

Sekvenserne oversættes med Virtual Ribosome, hvilket giver følgende FASTA fil:

>pigeon_alpha-globin-D
MLTDSDKKLVLQVWEKVIRHPDCGAEALERLFTTYPQTKTYFPHFDLHHGSDQVRNHGKK
VLAALGNAVKSLGNLSQALSDLSDLHAYNLRVDPVNFKLLAQCFHVVLATHLGNDYTPEA
HAAFDKFLSAVCTVLAEKYR*
>pigeon_alpha-globin-A
MVLSANDKSNVKAVFGKIGGQAGDLGGEALERLFITYPQTKTYFPHFDLSHGSAQIKGHG
KKVAEALVEAANHIDDIAGALSKLSDLHAQKLRVDPVNFKLLGHCFLVVVAVHFPSLLTP
EVHASLDKFVCAVGTVLTAKYR*
>duck_alpha-globin-D
MLTAEDKKLIVQVWEKVAGHQEEFGSEALQRMFLAYPQTKTYFPHFDLHPGSEQVRGHGK
KVAAALGNAVKSLDNLSQALSELSNLHAYNLRVDPVNFKLLAQCFQVVLAAHLGKDYSPE
MHAAFDKFLSAVAAVLAEKYR*
>duck_alpha-A-globin
MVLSAADKTNVKGVFSKIGGHAEEYGAETLERMFIAYPQTKTYFPHFDLQHGSAQIKAHG
KKVAAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPAALTP
EVHASLDKFMCAVGAVLTAKYR*
>Goat_alpha-i-globin
MVLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHLPNDFTP
AVHASLDKFLANVSTVLTSKYR*
>Goat_alpha-ii-globin
MVLSAADKSNVKAAWGKVGSNAGAYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
EKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHSLLVTLACHHPSDFTP
AVHASLDKFLANVSTVLTSKYR*
>Horse_alpha-1_globin
MVLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG
KKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP
AVHASLDKFLSSVSTVLTSKYR*
>Horse_alpha-2_globin
MVLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHG
QKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP
AVHASLDKFLSSVSTVLTSKYR*
>Chicken_alpha-D
MLTAEDKKLIQQAWERAASHQEEFGAEALTRMFTTYPQTKTYFPHFDLSPGSDQVRGHGK
KVLGALGNAVKNVDNLSQAMAELSNLHAYNLRVDPVNFKLLSQCIQVVLAVHMGKDYTPE
VHAAFDKFLSAVSAVLAEKYR*
>Chicken_alpha-A
MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHFDLSHGSAQIKGHG
KKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPAALTP
EVHASLDKFLCAVGTVLTAKYR*

Efterfølgende alignes de med MAFFT.

Observationer:

  • Stort set samme træ på peptid-niveau som på DNA-niveau (lidt forskelle i længderne af grenene).
  • Nu ses der klart to bevarede områder.

Spørgsmål 4

FASTA fil:

>Sheep_U00659
ATGGCCCTGTGGACACGCCTGGTGCCCCTGCTGGCCCTGCTGGCACTCTGGGCCCCCGCC
CCGGCCCACGCCTTCGTCAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGAGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGCCGGGAGGTGGAGGGC
CCCCAGGTGGGGGCGCTGGAGCTGGCCGGAGGCCCCGGCGCGGGTGGCCTGGAGGGGCCC
CCGCAGAAGCGTGGCATCGTGGAGCAGTGCTGCGCCGGCGTCTGCTCTCTCTACCAGCTG
GAGAACTACTGTAACTAG
>Pig_AY044828
ATGGCCCTGTGGACGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCCCTCTGGGCGCCCGCC
CCGGCCCAGGCCTTCGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGTCGGGAGGCGGAGAAC
CCTCAGGCAGGTGCCGTGGAGCTGGGCGGAGGCCTGGGCGGCCTGCAGGCCCTGGCGCTG
GAGGGGCCCCCGCAGAAGCGTGGCATCGTGGAGCAGTGCTGCACCAGCATCTGTTCCCTC
TACCAGCTGGAGAACTACTGCAACTAG
>Pig_AY242098
ATGGCCCTGTGGACGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCCCTCTGGGCGCCCGCC
CCGGCCCAGGCCTTCGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGTCGGGAGGCGGAGAAC
CCTCAGGCAGGTGCCGTGGAGCTGGGCGGAGGCCTGGGCGGCCTGCAGGCCCTGGCGCTG
GAGGGGCCCCCGCAGAAGCGTGGCATCGTGGAGCAGTGCTGCACCAGCATCTGTTCCCTC
TACCAGCTGGAGAACTACTGCAACTAG
>Pig_AY242100
ATGGCCCTGTGGACGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCGCTCTGGGCGCCCGCC
CCGGCCCAGGCCTTCGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGTCGGGAGGCGGAGAAC
CCTCAGGCAGGTGCCGTGGAGCTGGGCGGAGGCCTGGGCGGCCTGCAGGCCCTGGCGCTG
GAGGGGCCCCCGCAGAAGCGTGGCATCGTGGAGCAGTGCTGCACCAGCATCTGTTCCCTC
TACCAGCTGGAGAACTACTGCAACTAG
>Pig_AY242101
ATGGCCCTGTGGACGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCGCTCTGGGCGCCCGCC
CCGGCCCAGGCCTTCGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGTCGGGAGGCGGAGAAC
CCTCAGGCAGGTGCCGTGGAGCTGGGCGGAGGCCTGGGCGGCCTGCAGGCCCTGGCGCTG
GAGGGGCCCCCGCAGAAGCGTGGCATCGTGGAGCAGTGCTGCACCAGCATCTGTTCCCTC
TACCAGCTGGAGAACTACTGCAACTAG
>Pig_AY242109
ATGGCCCTGTGGACGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCGCTCTGGGCGCCCGCC
CCGGCCCAGGCCTTCGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAGGCGCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCCAAGGCCCGTCGGGAGGCGGAGAAC
CCTCAGGCAGGTGCCGTGGAGCTGGGCGGAGGCCTGGGCGGCCTGCAGGCCCTGGCGCTG
GAGGGGCCCCCGCAGAAGCGTGGCATCGTAGAGCAGTGCTGCACCAGCATCTGTTCCCTC
TACCAGCTGGAGAACTACTGCAACTAG
>Dog_V00179
ATGGCCCTCTGGATGCGCCTCCTGCCCCTGCTGGCCCTGCTGGCCCTCTGGGCGCCCGCG
CCCACCCGAGCCTTCGTTAACCAGCACCTGTGTGGCTCCCACCTGGTAGAGGCTCTGTAC
CTGGTGTGCGGGGAGCGCGGCTTCTTCTACACGCCTAAGGCCCGCAGGGAGGTGGAGGAC
CTGCAGGTGAGGGACGTGGAGCTGGCCGGGGCGCCTGGCGAGGGCGGCCTGCAGCCCCTG
GCCCTGGAGGGGGCCCTGCAGAAGCGAGGCATCGTGGAGCAGTGCTGCACCAGCATCTGC
TCCCTCTACCAGCTGGAGAATTACTGCAACTAG
>OwlMonkey_J02989
ATGGCCCTGTGGATGCACCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCCGAG
CCAGCCCCGGCCTTTGTGAACCAGCACCTGTGCGGCCCCCACCTGGTGGAAGCCCTCTAC
CTGGTGTGCGGGGAGCGAGGTTTCTTCTACGCACCCAAGACCCGCCGGGAGGCGGAGGAC
CTGCAGGTGGGGCAGGTGGAGCTGGGTGGGGGCTCTATCACGGGCAGCCTGCCACCCTTG
GAGGGTCCCATGCAGAAGCGTGGCGTCGTGGATCAGTGCTGCACCAGCATCTGCTCCCTC
TACCAGCTGCAGAACTACTGCAACTAG
>Human_AY138590
ATGGCCCTGTGGATGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGAC
CCAGCCGCAGCCTTTGTGAACCAACACCTGTGCGGCTCACACCTGGTGGAAGCTCTCTAC
CTAGTGTGCGGGGAACGAGGCTTCTTCTACACACCCAAGACCCGCCGGGAGGCAGAGGAC
CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
GCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGC
TCCCTCTACCAGCTGGAGAACTACTGCAACTAG
>GreenMonkey_X61092
ATGGCCCTGTGGATGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGAC
CCGGTCCCGGCCTTTGTGAACCAGCACCTGTGCGGCTCCCACCTGGTGGAAGCCCTCTAC
CTGGTGTGCGGGGAGCGAGGCTTCTTCTACACGCCCAAGACCCGCCGGGAGGCAGAGGAC
CCGCAGGTGGGGCAGGTAGAGCTGGGCGGGGGCCCTGGCGCAGGCAGCCTGCAGCCCTTG
GCGCTGGAGGGGTCCCTGCAGAAGCGCGGCATCGTGGAGCAGTGCTGTACCAGCATCTGC
TCCCTCTACCAGCTGGAGAACTACTGCAACTAG
>Human_J00265
ATGGCCCTGTGGATGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGAC
CCAGCCGCAGCCTTTGTGAACCAACACCTGTGCGGCTCACACCTGGTGGAAGCTCTCTAC
CTAGTGTGCGGGGAACGAGGCTTCTTCTACACACCCAAGACCCGCCGGGAGGCAGAGGAC
CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
GCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGC
TCCCTCTACCAGCTGGAGAACTACTGCAACTAG
>Chimp_X61089
ATGGCCCTGTGGATGCGCCTCCTGCCCCTGCTGGTGCTGCTGGCCCTCTGGGGACCTGAC
CCAGCCTCGGCCTTTGTGAACCAACACCTGTGCGGCTCCCACCTGGTGGAAGCTCTCTAC
CTAGTGTGCGGGGAACGAGGCTTCTTCTACACACCCAAGACCCGCCGGGAGGCAGAGGAC
CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
GCCCTGGAGGGGTCCCTGCAGAAGCGTGGTATCGTGGAACAATGCTGTACCAGCATCTGC
TCCCTCTACCAGCTGGAGAACTACTGCAACTAG
>GuineaPig_K02233
ATGGCTCTGTGGATGCATCTCCTCACCGTGCTGGCCCTGCTGGCCCTCTGGGGGCCCAAC
ACTAATCAGGCCTTTGTCAGCCGGCATCTGTGCGGCTCCAACTTAGTGGAGACATTGTAT
TCAGTGTGTCAGGATGATGGCTTCTTCTATATACCCAAGGACCGTCGGGAGCTAGAGGAC
CCACAGGTGGAGCAGACAGAACTGGGCATGGGCCTGGGGGCAGGTGGACTACAGCCCTTG
GCACTGGAGATGGCACTACAGAAGCGTGGCATTGTGGATCAGTGCTGTACTGGCACCTGC
ACACGCCACCAGCTGCAGAGCTACTGCAACTAG
>Mouse_X04725
ATGGCCCTGTTGGTGCACTTCCTACCCCTGCTGGCCCTGCTTGCCCTCTGGGAGCCCAAA
CCCACCCAGGCTTTTGTCAAACAGCATCTTTGTGGTCCCCACCTGGTAGAGGCTCTCTAC
CTGGTGTGTGGGGAGCGTGGCTTCTTCTACACACCCAAGTCCCGCCGTGAAGTGGAGGAC
CCACAAGTGGAACAACTGGAGCTGGGAGGAAGCCCCGGGGACCTTCAGACCTTGGCGTTG
GAGGTGGCCCGGCAGAAGCGTGGCATTGTGGATCAGTGCTGCACCAGCATCTGCTCCCTC
TACCAGCTGGAGAACTACTGCAACTAA
>Chicken_AY438372
ATGGCTCTCTGGATCCGATCACTGCCTCTTCTGGCTCTCCTTGTCTTTTCTGGCCCTGGA
ACCAGCTATGCAGCTGCCAACCAGCACCTCTGTGGCTCCCACTTGGTGGAGGCTCTCTAC
CTGGTGTGTGGAGAGCGTGGCTTCTTCTACTCCCCCAAAGCCCGACGGGATGTCGAGCAG
CCCCTAGTGAGCAGTCCCTTGCGTGGCGAGGCAGGAGTGCTGCCTTTCCAGCAGGAGGAA
TACGAGAAAGTCAAGCGAGGGATTGTTGAGCAATGCTGCCATAACACGTGTTCCCTCTAC
CAACTGGAGAACTACTGCAACTAG

Spørgsmål 5

  • Nej, alle gaps har en længde som er et multiplum af 3 — men det er ikke alle gaps der følger codon-grænser, se f.eks. nedenfor, hvor et gap i kylling og et gap i mus overlapper med to positioner. Alignment algoritmen kender ikke noget til at sekvenserne er protein-kodende, så den kigger kun på DNA'et.
Sheep_U00659    CCCCAGGTGGGGGCGCTGGAGCTGGCCGGAGGCCCCGGCGCGGGTGGC------------
Pig_AY044828    CCTCAGGCAGGTGCCGTGGAGCTGGGCGGA------GGCCTGGGCGGCCTGCAGGCCCTG
Pig_AY242098    CCTCAGGCAGGTGCCGTGGAGCTGGGCGGA------GGCCTGGGCGGCCTGCAGGCCCTG
Pig_AY242100    CCTCAGGCAGGTGCCGTGGAGCTGGGCGGA------GGCCTGGGCGGCCTGCAGGCCCTG
Pig_AY242101    CCTCAGGCAGGTGCCGTGGAGCTGGGCGGA------GGCCTGGGCGGCCTGCAGGCCCTG
Pig_AY242109    CCTCAGGCAGGTGCCGTGGAGCTGGGCGGA------GGCCTGGGCGGCCTGCAGGCCCTG
Dog_V00179      CTGCAGGTGAGGGACGTGGAGCTGGCCGGGGCGCCTGGCGAGGGCGGCCTGCAGCCCCTG
OwlMonkey_J0298 CTGCAGGTGGGGCAGGTGGAGCTGGGTGGGGGCTCTATCACGGGCAGCCTGCCACCCT--
Human_AY138590  CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
Human_J00265    CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
Chimp_X61089    CTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCCTGCAGCCCTTG
GreenMonkey_X61 CCGCAGGTGGGGCAGGTAGAGCTGGGCGGGGGCCCTGGCGCAGGCAGCCTGCAGCCCTTG
Mouse_X04725    CCACAAGTGGAACAACTGGAGCTGGGAGGAAGCCCCGGGG------ACCTTCAGACCTTG
GuineaPig_K0223 CCACAGGTGGAGCAGACAGAACTGGGCATGGGCCTGGGGGCAGGTGGACTACAGCCCTTG
Chicken_AY43837 CCCCTAGTGAGCAGTCCCTTGCGTGGCGAG------------GCAGGAGTGCTGCCTTTC
                *  *:.* ...        :.*  *  . .                ..            
  • Kylling skiller sig ud - den er også den eneste der ikke er et pattedyr.
  • Ved at slå visning af afstande i træet til ses det at de to humane sekvenser er 100% ens (afstanden er 0) — man kan altså smide den ene ud — og for grisen er følgende sekvenser ens:
>Pig_AY044828
>Pig_AY242098

samt

>Pig_AY242100
>Pig_AY242101

(man kan altså smide to grise-sekvenser ud af sættet).

Spørgsmål 6

Sekvenserne oversættes med Virtual Ribosome, hvilket giver følgende sekvenser:

>Sheep_U00659
MALWTRLVPLLALLALWAPAPAHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN*
>Pig_AY044828
MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
PQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
>Pig_AY242098
MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
PQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
>Pig_AY242100
MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
PQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
>Pig_AY242101
MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
PQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
>Pig_AY242109
MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
PQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
>Dog_V00179
MALWMRLLPLLALLALWAPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVED
LQVRDVELAGAPGEGGLQPLALEGALQKRGIVEQCCTSICSLYQLENYCN*
>OwlMonkey_J02989
MALWMHLLPLLALLALWGPEPAPAFVNQHLCGPHLVEALYLVCGERGFFYAPKTRREAED
LQVGQVELGGGSITGSLPPLEGPMQKRGVVDQCCTSICSLYQLQNYCN*
>Human_AY138590
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
>GreenMonkey_X61092
MALWMRLLPLLALLALWGPDPVPAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
PQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
>Human_J00265
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
>Chimp_X61089
MALWMRLLPLLVLLALWGPDPASAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
>GuineaPig_K02233
MALWMHLLTVLALLALWGPNTNQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELED
PQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN*
>Mouse_X04725
MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN*
>Chicken_AY438372
MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ
PLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN*

Efterfølgende alignes sekvenserne med ClustalW.

  • Bemærk hvordan de to gaps i mus og kylling jeg nævnte i spg. 5 nu overlapper helt.
Sheep_U00659    PQVGALELAGGPG-----AGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN*
Pig_AY044828    PQAGAVELGGGLG--GLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
Pig_AY242098    PQAGAVELGGGLG--GLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
Pig_AY242100    PQAGAVELGGGLG--GLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
Pig_AY242101    PQAGAVELGGGLG--GLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
Pig_AY242109    PQAGAVELGGGLG--GLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN*
Dog_V00179      LQVRDVELAGAPGEGGLQPLALEGALQKRGIVEQCCTSICSLYQLENYCN*
Human_AY138590  LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
Human_J00265    LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
Chimp_X61089    LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
GreenMonkey_X61 PQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN*
OwlMonkey_J0298 LQVGQVELGGGSITGSLPP--LEGPMQKRGVVDQCCTSICSLYQLQNYCN*
Mouse_X04725    PQVEQLELGGSPG--DLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN*
GuineaPig_K0223 PQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN*
Chicken_AY43837 PLVSS-PLRGEAG--VLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN*
                  .    *              *    ***:*:*** . *: :**:.****
  • Det ses nu at på protein-niveau er alle grise-sekvenserne helt ens. Man kan altså smide fire ud.

Spørgsmål 7

Svar til pkt. 5 i http://www.cbs.dtu.dk/courses/biosys/binfintro/mulalign.php: Nej, der er ikke nogen af de tre metoder der klarer det perfekt, men MAFFT er tæt på, den placerer kun et enkelt bogstav (et Q) forkert.

Spørgsmål 8

  • Ja - gaps går op i tre.
  • Ja - da DNA alignmentet er genereret med et protein-alignment som skabelon.
  • Ja - der er nogle korte stræk af baser, der er med små bogstaver.
Personal tools