Exercise: Pairwise alignment
From teachingmaterials
Exercise written by: Rasmus Wernersson, with modifications by Anne Bresciani, Ulrich Johan Kudahl, Anders Gorm Pedersen and Henrik Nielsen.
Contents |
Introduction
In this exercise we will be working with pairwise alignment of protein sequences. As explained in today's lecture, pairwise alignment is performed using an algorithm known as Dynamic Programming (DP). In this exercise we will not go into further details about the mathematics behind the algorithm, but rather focus on the practical use of Pairwise Alignment, and how to critically evaluate the result.
Keep the following in mind as we go through the exercise (as mentioned in the lecture):
- The quality of an alignment is assessed through its alignment score.
- The alignment score is calculated based on match/mismatch of the amino acids via look-ups in a substitution matrix (for example BLOSUM62). The penalty for introducing gaps in the alignment is governed by two parameters: Gap opening ("expensive" - big penalty, e.g. 10 points) and Gap elongation ("cheap", e.g. 1 point).
- The BLOSUM substitution matrices are based on empirical data: substitutions that are seen frequently in real proteins have a higher score. We don't cover DNA matrices in this exercise.
- There are two main variants of the DP algorithm:
- Global alignment (Needleman-Wunsch) — the sequences are forced to be aligned across their entire length.
- Local alignment (Smith-Waterman) — only the best matching sub-part of the sequences are aligned).
Part 1 — basic use
| Error creating thumbnail: convert: unable to open image `/net/genome/usr/opt/www/pub/wiki/27611/images/d/d2/PairwiseAlignment.png': /usr/lib64/ImageMagick-6.6.1/modules-Q16/coders/png.la @ error/blob.c/OpenBlob/2489. convert: unable to open image `/net/genome/usr/opt/www/pub/wiki/27611/images/d/d2/PairwiseAlignment.png': @ error/blob.c/OpenBlob/2489. convert: unable to open file `/net/genome/usr/opt/www/pub/wiki/27611/images/d/d2/PairwiseAlignment.png' @ error/png.c/ReadPNGImage/3014. convert: missing an image filename `/net/genome/usr/opt/www/pub/wiki/27611/images/thumb/d/d2/PairwiseAlignment.png/210px-PairwiseAlignment.png' @ error/convert.c/ConvertImageCommand/2970. |
Open the alignment webpage at EBI: http://www.ebi.ac.uk/Tools/psa/ .
Notice that
- EBI has help pages for the tools we are going to use. Unfortunately, they are not very easy to find, but here are the direct links:
- Needle (global alignment): http://www.ebi.ac.uk/Tools/psa/emboss_needle/help/index-protein.html
- Water (local alignment): http://www.ebi.ac.uk/Tools/psa/emboss_water/help/index-protein.html
- In addition, some of the general tutorial pages at EBI can be relevant for this exercise:
- Alignment: http://www.ebi.ac.uk/2can/tutorials/alignment.html
- Gaps: http://www.ebi.ac.uk/2can/tutorials/gaps.html
- Substitution matrices: http://www.ebi.ac.uk/2can/tutorials/matrices.html
- as described in the help pages, a number of sequence formats are supported (e.g. FASTA).
For starters we will work with a pair of prokaryotic serine-proteases (both retrieved from UniProt). The first one (P29600) is the thermostable protease that the company Novozymes sells to the washing-powder industry under the trade-name "Savinase". The other sequence is likewise a thermostable serine-protease, but from a different species of Bacillus.
>P29600|SUBS_BACLE Subtilisin Savinase - Bacillus lentus AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGN GHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVA NLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNR ASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQI RNHLKNTATSLGSTNLYGSGLVNAEAATR >P41363|ELYA_BACHD Thermostable alkaline protease precursor - Bacillus halodurans MRQSLKVMVLSTVALLFMANPAAASEEKKEYLIVVEPEEVSAQSVEESYDVDVIHEFEEI PVIHAELTKKELKKLKKDPNVKAIEKNAEVTISQTVPWGISFINTQQAHNRGIFGNGARV AVLDTGIASHPDLRIAGGASFISSEPSYHDNNGHGTHVAGTIAALNNSIGVLGVAPSADL YAVKVLDRNGSGSLASVAQGIEWAINNNMHIINMSLGSTSGSSTLELAVNRANNAGILLV GAAGNTGRQGVNYPARYSGVMAVAAVDQNGQRASFSTYGPEIEISAPGVNVNSTYTGNRY VSLSGTSMATPHVAGVAALVKSRYPSYTNNQIRQRINQTATYLGSPSLYGNGLVHAGRAT Q
- Question 1: Which sequence format are the two sequences listed in?
- Now, In the Needle section (Short for Needleman & Wunsch) at the site http://www.ebi.ac.uk/Tools/psa/, Click the button labeled "Protein" and paste in the sequences - including the header line - one sequence in each search box.
- Click the button labeled "More options" (under "STEP 2") and ensure that Matrix is set to "BLOSUM62"
- Also under "options" ("STEP 2") set End Gap Penalty to "true" (otherwise, the algorithm ignores gaps at the very ends of the alignments, i.e. gaps positioned at the end of one of the sequences would not cost anything).
- Finally, start the alignment by clicking the button labeled "Submit"
- Have a look at the result. Notice that the degree of similarity between aligned amino acids is indicated with the following symbols: "|" indicates a perfect match, ":" indicates a "close" mismatch (positive value on the BLOSUM matrix, also known as a conservative substitution — the amino acids share some physico-chemical properties), and "." indicates a "far" mismatch (zero or negative value on the BLOSUM matrix).
- Question 2: Report the following values / observations from the alignment.
- Alignment score
- Alignment length
- % and fraction Identity (The value reported for "Identity" includes perfect matches only)
- % and fraction Similarity (The value reported for "Similarity" includes perfect matches + "close" mismatches)
- Now, perform the alignment once again (preferably in a new browser tab/window, so it's easy to compare), but this time use the Water (short for Smith-Waterman) algorithm. This can (again) be found on http://www.ebi.ac.uk/Tools/psa/ . Again use protein alignment.
- Question 3: Report the same values as above (Alignment score etc). Consider the alignments produced by the two different approaches: do YOU think one of them is more biologically relevant than the other, or do both contribute valuable information?
- Question 4:
- Let's go a bit deeper into why the two sequences differ in the N-terminal part: Look up both entries in UniProt (http://www.uniprot.org) and try to locate information regarding the following questions.
- How were the amino acid sequences of the two proteins determined? (Hint: look at the titles of the papers, and the Cited for fields, listed in the Reference sections).
- Subcellular localization: Where in (or outside) the cell do the enzymes function?
- The Sequence Annotation table contains details about the regions/domains of the protein - try and do a comparison to spot the differences between the two UniProt entries (Hint: focus on the "Molecule processing" sections).
- Question 5: Based on what you've learned about the P41363 protein from the alignment to Savinase and from the data on the Uniprot site: do you think this could be used as an enzyme in washing powder? (Why? / why not?).
Part 2 — about gaps and dubious alignments
So far we have been comparing sequences that are relatively closely related. It's now the time to compare our prokaryotic Savinase (P29600) protease with a human peptidase (a Tripeptidyl Peptidase), and see if they are related at all.
>sp|P29144|TPP2_HUMAN Tripeptidyl-peptidase 2 MATAATEEPFPFHGLLPKKETGAASFLCRYPEYDGRGVLIAVLDTGVDPGAPGMQVTTDG KPKIVDIIDTTGSGDVNTATEVEPKDGEIVGLSGRVLKIPASWTNPSGKYHIGIKNGYDF YPKALKERIQKERKEKIWDPVHRVALAEACRKQEEFDVANNGSSQANKLIKEELQSQVEL LNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAE MLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTR LSTMETGTGLIRAMIEVINHKCDLVNYSYGEATHWPNSGRICEVINEAVWKHNIIYVSSA GNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSADGAL GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALILSGLKANNIDYTVHSVRR ALENTAVKADNIEVFAQGHGIIQVDKAYDYLVQNTSFANKLGFTVTVGNNRGIYLRDPVQ VAAPSDHGVGIEPVFPENTENSEKISLQLHLALTSNSSWVQCPSHLELMNQCRHINIRVD PRGLREGLHYTEVCGYDIASPNAGPLFRVPITAVIAAKVNESSHYDLAFTDVHFKPGQIR RHFIEVPEGATWAEVTVCSCSSEVSAKFVLHAVQLVKQRAYRSHEFYKFCSLPEKGTLTE AFPVLGGKAIEFCIARWWASLSDVNIDYTISFHGIVCTAPQLNIHASEGINRFDVQSSLK YEDLAPCITLKNWVQTLRPVSAKTKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPSC PLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQYSLKLEKGDYTIRLQIRHEQISDL ERLKDLPFIVSHRLSNTLSLDIHENHSFALLGKKKSSNLTLPPKYNQPFFVTSLPDDKIP KGAGPGCYLAGSLTLSKTELGKKADVIPVHYYLIPPPTKTKNGSKDKEKDSEKEKDLKEE FTEALRDLKIQWMTKLDSSDIYNELKETYPNYLPLYVARLHQLDAEKERMKRLNEIVDAA NAVISHIDQTALAVYIAMKTDPRPDAATIKNDMDKQKSTLVDALCRKGCALADHLLHTQA QDGAISTDAEGKEEEGESPLDSLAETFWETTKWTDLFDNKVLTFAYKHALVNKMYGRGLK FATKLVEEKPTKENWKNCIQLMKLLGWTHCASFTENWLPIMYPPDYCVF
- Question 6: Compare Savinase to the human peptidase by global alignment (Needle) — remember again to set End Gap Penalty to "true" — and report the following:
- Alignment score
- Alignment length
- Identity and Similarity
- How large a part of the alignment is gaps?
- Question 7: Repeat the alignment with End Gap Penalty set to "false" and report the same results as above.
- Question 8: Repeat the alignment again — this time using the local alignment algorithm (Water) — and report the same results as above.
- Question 9: Do you think local or global alignment is best for finding similar parts of distantly related proteins? Why?
- Hint: Distantly related proteins typically share a core, that relates to the function of the protein
Now we need to investigate if we believe the two peptidases are truly evolutionarily related. Before discussing confidence intervals of alignment score / homology, let's have a look at how an alignment of two unrelated sequences looks. If a sequence is shuffled (i.e. the amino acids are reordered randomly), any signature of its evolutionary relationships will be erased, and it will appear unrelated to any protein.
- Open the SeqShuffle Server (http://www.cbs.dtu.dk/biotools/SeqShuffle-1.0/) in a new window/tab, paste in the tripeptidyl peptidase sequence and shuffle it.
- Then align Savinase and the shuffled tripeptidyl peptidase sequence using local alignment.
- Repeat the above procedure two more times, so that you align Savinase with three different shuffled versions of tripeptidyl peptidase.
- Question 10: How do the local alignments look? (What are the ranges of Alignment score, Alignment length, Identity, Similarity, and gap percentage)?
- Question 11: Comparing the Savinase/shuffled alignment to the previous Savinase/Human Peptidase alignment - how will you judge the alignment with human peptidase now? (More/Less confidence in relation between the sequences?).
Part 3 — about parameters
The third part of the exercise is meant to illustrate that alignments is dependent on parameters. We can make anything look like similar sequences, if we twist the parameters enough.
- Choose the Matrix: Let's see how the alignment depends on the choice of substitution matrix.
- Go the the page for local protein alignment.
- Click "More Options"
- Choose the substitution matrix "BLOSUM90" instead of the default (BLOSUM62)
- Align Savinase and Tripeptidyl Peptidase
- Redo the alignment, this time with the matrix "BLOSUM30"
- You can see the BLOSUM matrices on this page: BLOSUM matrix examples
- Question 12:
- What are the alignment results (Length, score, gaps, identity, similarity)?
- How do alignment length and % identity depend on the BLOSUM number (compare also to your answer to question 8)?
- Release the Gaps!: As the last part of the comparison of sequences — let's allow as many gaps as possible, by making it almost "free" for the algorithm to insert gaps.
- Go the the page for local protein alignment.
- Click "More Options"
- Set the matrix back to "BLOSUM62"
- Set the Gap opening penalty to 1.0 (smallest possible value).
- Set the Gap extend penalty to 0.0005 (smallest possible value).
- Align Savinase and Tripeptidyl Peptidase
- Question 13:
- How do the quality parameters look this time (Length, score, gaps, identity, similarity)?
- Is this alignment biologically meaningful at all?
Epilogue — mostly for fun
Go to UniProt and find the sequences with the IDs GLBE_CHITH and GLB7A_CHITH. These are two globins from a midge, a very small and annoying insect. If you have ever been to Scotland in the summer, you will know about midges. Make a global alignment of GLBE_CHITH and GLB7A_CHITH.
- Question 14:
- Note that there is a gap of 6 positions in GLBE_CHITH. What is the corresponding 6 amino acid long sequence of GLB7A_CHITH? This is an authentic example! Nature truly is fascinating...
